"MDP1" Related Products

Expand

Recombinant Human MDP1, His-tagged

Cat.No.: MDP1-27383TH
Product Overview: Recombinant full length Human MDP1 with an N terminal His tag ; predicted MWt: 22.7 kDa.
Description: MDP1 (Magnesium-dependent phosphatase 1) belongs to the HAD-like hydrolase superfamily. This protein is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. It is inhibited by vanadate and zinc, and slightly by calcium.
Protein length: 176 amino acids
Conjugation: HIS
Molecular Weight: 22.700kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Gene Name: MDP1 magnesium-dependent phosphatase 1 [ Homo sapiens ]
Official Symbol: MDP1
Synonyms: MDP1; magnesium-dependent phosphatase 1; FN6Pase; fructosamine 6 phosphatase; MGC5987;
Gene ID: 145553
mRNA Refseq: NM_001199822
Protein Refseq: NP_001186751
Uniprot ID: Q86V88
Chromosome Location: 14q12
Function: hydrolase activity; metal ion binding; protein tyrosine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.