Recombinant Full Length Human MDP1 Protein, GST-tagged

• Cat.No.: MDP1-6434HF
• Product Overview: Human MGC5987 full-length ORF ( NP_612485.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 176 amino acids
• Description: MDP1 (Magnesium Dependent Phosphatase 1) is a Protein Coding gene. GO annotations related to this gene include phosphatase activity and protein tyrosine phosphatase activity. An important paralog of this gene is NEDD8-MDP1.
• Molecular Mass: 46.5 kDa
• AA Sequence: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MDP1 magnesium dependent phosphatase 1 [ Homo sapiens (human) ]
• Official Symbol: MDP1
• Synonyms: MDP1; magnesium dependent phosphatase 1; MDP-1; FN6PASE; magnesium-dependent phosphatase 1; fructosamine-6-phosphatase; EC 3.1.3.48
• Gene ID: 145553
• mRNA Refseq: NM_001199821
• Protein Refseq: NP_001186750
• UniProt ID: Q86V88