"MSI1" Related Products

Expand

Recombinant Human MSI1

Cat.No.: MSI1-30259TH
Product Overview: Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag.
Description: This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Protein length: 362 amino acids
Molecular Weight: 65.890kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Sequence Similarities: Belongs to the Musashi family.Contains 2 RRM (RNA recognition motif) domains.
Gene Name: MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol: MSI1
Synonyms: MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1;
Gene ID: 4440
mRNA Refseq: NM_002442
Protein Refseq: NP_002433
MIM: 603328
Uniprot ID: O43347
Chromosome Location: 12q24
Pathway: mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem;
Function: RNA binding; nucleotide binding; poly(U) RNA binding; single-stranded RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.