Recombinant Human NT5M, His-tagged

• Cat.No.: NT5M-29347TH
• Product Overview: Recombinant full length mature Human NT5M (amino acids 32-171) with a N terminal His tag. 218 amino acids with a predicted MWt 25.1 kDa including tag.

Specification

• Description: This gene encodes a 5 nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5- and 2(3)-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Protein length: 197 amino acids
• Conjugation: HIS
• Molecular Weight: 25.100kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFE GGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGL SEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFI CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT VVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC
• Sequence Similarities: Belongs to the 5(3)-deoxyribonucleotidase family.

Gene Information

• Gene Name: NT5M 5,3-nucleotidase, mitochondrial [ Homo sapiens ]
• Official Symbol: NT5M
• Synonyms: NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN
• Gene ID: 56953
• mRNA Refseq: NM_020201
• Protein Refseq: NP_064586
• MIM: 605292
• Uniprot ID: Q9NPB1
• Chromosome Location: 17p11.2
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem
• Function: 5-nucleotidase activity; 5-nucleotidase activity; hydrolase activity; metal ion binding; nucleotidase activity