"NT5M" Related Products

Expand

Recombinant Human NT5M, His-tagged

Cat.No.: NT5M-29347TH
Product Overview: Recombinant full length mature Human NT5M (amino acids 32-171) with a N terminal His tag. 218 amino acids with a predicted MWt 25.1 kDa including tag.
Description: This gene encodes a 5 nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5- and 2(3)-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Protein length: 197 amino acids
Conjugation: HIS
Molecular Weight: 25.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFE GGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGL SEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFI CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT VVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC
Sequence Similarities: Belongs to the 5(3)-deoxyribonucleotidase family.
Gene Name: NT5M 5,3-nucleotidase, mitochondrial [ Homo sapiens ]
Official Symbol: NT5M
Synonyms: NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN;
Gene ID: 56953
mRNA Refseq: NM_020201
Protein Refseq: NP_064586
MIM: 605292
Uniprot ID: Q9NPB1
Chromosome Location: 17p11.2
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem;
Function: 5-nucleotidase activity; 5-nucleotidase activity; hydrolase activity; metal ion binding; nucleotidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.