Recombinant Human NT5M, His-tagged

Cat.No. : NT5M-29347TH
Product Overview : Recombinant full length mature Human NT5M (amino acids 32-171) with a N terminal His tag. 218 amino acids with a predicted MWt 25.1 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 197 amino acids
Description : This gene encodes a 5 nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5- and 2(3)-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Conjugation : HIS
Molecular Weight : 25.100kDa inclusive of tags
Tissue specificity : Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFE GGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGL SEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFI CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT VVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC
Sequence Similarities : Belongs to the 5(3)-deoxyribonucleotidase family.
Gene Name NT5M 5,3-nucleotidase, mitochondrial [ Homo sapiens ]
Official Symbol NT5M
Synonyms NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN;
Gene ID 56953
mRNA Refseq NM_020201
Protein Refseq NP_064586
MIM 605292
Uniprot ID Q9NPB1
Chromosome Location 17p11.2
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem;
Function 5-nucleotidase activity; 5-nucleotidase activity; hydrolase activity; metal ion binding; nucleotidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NT5M Products

Required fields are marked with *

My Review for All NT5M Products

Required fields are marked with *

0

Inquiry Basket

cartIcon