Recombinant Human NT5M, His-tagged
| Cat.No. : | NT5M-29347TH |
| Product Overview : | Recombinant full length mature Human NT5M (amino acids 32-171) with a N terminal His tag. 218 amino acids with a predicted MWt 25.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 197 amino acids |
| Description : | This gene encodes a 5 nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5- and 2(3)-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Conjugation : | HIS |
| Molecular Weight : | 25.100kDa inclusive of tags |
| Tissue specificity : | Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFE GGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGL SEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFI CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT VVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC |
| Sequence Similarities : | Belongs to the 5(3)-deoxyribonucleotidase family. |
| Gene Name | NT5M 5,3-nucleotidase, mitochondrial [ Homo sapiens ] |
| Official Symbol | NT5M |
| Synonyms | NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN; |
| Gene ID | 56953 |
| mRNA Refseq | NM_020201 |
| Protein Refseq | NP_064586 |
| MIM | 605292 |
| Uniprot ID | Q9NPB1 |
| Chromosome Location | 17p11.2 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem; |
| Function | 5-nucleotidase activity; 5-nucleotidase activity; hydrolase activity; metal ion binding; nucleotidase activity; |
| ◆ Recombinant Proteins | ||
| Nt5m-1076R | Recombinant Rat Nt5m protein, His & T7-tagged | +Inquiry |
| NT5M-4489H | Recombinant Human NT5M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NT5M-1722H | Recombinant Human 5',3'-Nucleotidase, Mitochondrial, His-tagged | +Inquiry |
| NT5M-6231M | Recombinant Mouse NT5M Protein, His (Fc)-Avi-tagged | +Inquiry |
| NT5M-29347TH | Recombinant Human NT5M, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NT5M-3673HCL | Recombinant Human NT5M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5M Products
Required fields are marked with *
My Review for All NT5M Products
Required fields are marked with *
