Recombinant Human NT5M Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NT5M-4489H |
Product Overview : | NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
Molecular Mass : | 25.9 kDa |
AA Sequence : | MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NT5M 5',3'-nucleotidase, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | NT5M |
Synonyms | NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN; deoxy-5-nucleotidase 2; 5(3)-deoxyribonucleotidase; mitochondrial 5 nucleotidase; dNT-2; |
Gene ID | 56953 |
mRNA Refseq | NM_020201 |
Protein Refseq | NP_064586 |
MIM | 605292 |
UniProt ID | Q9NPB1 |
◆ Recombinant Proteins | ||
NT5M-4489H | Recombinant Human NT5M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NT5M-6231M | Recombinant Mouse NT5M Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5M-29347TH | Recombinant Human NT5M, His-tagged | +Inquiry |
Nt5m-1075M | Recombinant Mouse Nt5m protein, His & T7-tagged | +Inquiry |
NT5M-1722H | Recombinant Human 5',3'-Nucleotidase, Mitochondrial, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5M-3673HCL | Recombinant Human NT5M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NT5M Products
Required fields are marked with *
My Review for All NT5M Products
Required fields are marked with *
0
Inquiry Basket