"PDE8A" Related Products

Expand
Expand

Recombinant Human PDE8A

Cat.No.: PDE8A-30226TH
Product Overview: Recombinant fragment, corresponding to amino acids 32-121 of Human PDE8A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa
Description: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Sequence Similarities: Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 1 PAS (PER-ARNT-SIM) domain.
Gene Name: PDE8A phosphodiesterase 8A [ Homo sapiens ]
Official Symbol: PDE8A
Synonyms: PDE8A; phosphodiesterase 8A; high affinity cAMP-specific and IBMX-insensitive 3,5-cyclic phosphodiesterase 8A; HsT19550;
Gene ID: 5151
mRNA Refseq: NM_001243137
Protein Refseq: NP_001230066
MIM: 602972
Uniprot ID: O60658
Chromosome Location: 15q25.3
Pathway: G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function: 3,5-cyclic-AMP phosphodiesterase activity; 3,5-cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.