Recombinant Human PDE8A

Cat.No. : PDE8A-30226TH
Product Overview : Recombinant fragment, corresponding to amino acids 32-121 of Human PDE8A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Sequence Similarities : Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 1 PAS (PER-ARNT-SIM) domain.
Gene Name PDE8A phosphodiesterase 8A [ Homo sapiens ]
Official Symbol PDE8A
Synonyms PDE8A; phosphodiesterase 8A; high affinity cAMP-specific and IBMX-insensitive 3,5-cyclic phosphodiesterase 8A; HsT19550;
Gene ID 5151
mRNA Refseq NM_001243137
Protein Refseq NP_001230066
MIM 602972
Uniprot ID O60658
Chromosome Location 15q25.3
Pathway G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function 3,5-cyclic-AMP phosphodiesterase activity; 3,5-cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDE8A Products

Required fields are marked with *

My Review for All PDE8A Products

Required fields are marked with *

0
cart-icon