Recombinant Human PDE8A
| Cat.No. : | PDE8A-30226TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 32-121 of Human PDE8A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Tissue specificity : | Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL |
| Sequence Similarities : | Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 1 PAS (PER-ARNT-SIM) domain. |
| Gene Name | PDE8A phosphodiesterase 8A [ Homo sapiens ] |
| Official Symbol | PDE8A |
| Synonyms | PDE8A; phosphodiesterase 8A; high affinity cAMP-specific and IBMX-insensitive 3,5-cyclic phosphodiesterase 8A; HsT19550; |
| Gene ID | 5151 |
| mRNA Refseq | NM_001243137 |
| Protein Refseq | NP_001230066 |
| MIM | 602972 |
| Uniprot ID | O60658 |
| Chromosome Location | 15q25.3 |
| Pathway | G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
| Function | 3,5-cyclic-AMP phosphodiesterase activity; 3,5-cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity; |
| ◆ Recombinant Proteins | ||
| PDE8A-6592M | Recombinant Mouse PDE8A Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDE8A-12564M | Recombinant Mouse PDE8A Protein | +Inquiry |
| PDE8A-3352R | Recombinant Rhesus monkey PDE8A Protein, His-tagged | +Inquiry |
| PDE8A-1608H | Recombinant Human PDE8A, His-tagged | +Inquiry |
| PDE8A-482H | Recombinant Human Phosphodiesterase 8A, GST-tagged, Active | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDE8A-3339HCL | Recombinant Human PDE8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE8A Products
Required fields are marked with *
My Review for All PDE8A Products
Required fields are marked with *
