"PFDN2" Related Products

Expand

Recombinant Human PFDN2, His-tagged

Cat.No. : PFDN2-28101TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human PFDN2 with N terminal His tag, 20kDa.
Description : This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 100 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGL ASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVL VERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Gene Name : PFDN2 prefoldin subunit 2 [ Homo sapiens ]
Official Symbol : PFDN2
Synonyms : PFDN2; prefoldin subunit 2; prefoldin 2;
Gene ID : 5202
mRNA Refseq : NM_012394
Protein Refseq : NP_036526
MIM : 613466
Uniprot ID : Q9UHV9
Chromosome Location : 1q23.3
Pathway : Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function : unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.