Recombinant Human PFDN2, His-tagged

Cat.No. : PFDN2-28101TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human PFDN2 with N terminal His tag, 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-154 a.a.
Description : This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 100 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGL ASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVL VERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Full Length : Full L.
Gene Name PFDN2 prefoldin subunit 2 [ Homo sapiens ]
Official Symbol PFDN2
Synonyms PFDN2; prefoldin subunit 2; prefoldin 2;
Gene ID 5202
mRNA Refseq NM_012394
Protein Refseq NP_036526
MIM 613466
Uniprot ID Q9UHV9
Chromosome Location 1q23.3
Pathway Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function unfolded protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFDN2 Products

Required fields are marked with *

My Review for All PFDN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon