Recombinant Human PFDN2, His-tagged
| Cat.No. : | PFDN2-28101TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-154 of Human PFDN2 with N terminal His tag, 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-154 a.a. |
| Description : | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 100 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGL ASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVL VERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
| Full Length : | Full L. |
| Gene Name | PFDN2 prefoldin subunit 2 [ Homo sapiens ] |
| Official Symbol | PFDN2 |
| Synonyms | PFDN2; prefoldin subunit 2; prefoldin 2; |
| Gene ID | 5202 |
| mRNA Refseq | NM_012394 |
| Protein Refseq | NP_036526 |
| MIM | 613466 |
| Uniprot ID | Q9UHV9 |
| Chromosome Location | 1q23.3 |
| Pathway | Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem; |
| Function | unfolded protein binding; |
| ◆ Recombinant Proteins | ||
| PFDN2-3380R | Recombinant Rhesus monkey PFDN2 Protein, His-tagged | +Inquiry |
| PFDN2-6651M | Recombinant Mouse PFDN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PFDN2-4281Z | Recombinant Zebrafish PFDN2 | +Inquiry |
| PFDN2-561H | Recombinant Human PFDN2 protein(Met1-Ser154), His-tagged | +Inquiry |
| PFDN2-3198R | Recombinant Rhesus Macaque PFDN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFDN2-3280HCL | Recombinant Human PFDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFDN2 Products
Required fields are marked with *
My Review for All PFDN2 Products
Required fields are marked with *
