"PNPO" Related Products

Expand
Expand
Expand

Recombinant Human PNPO, His-tagged

Cat.No. : PNPO-27512TH
Product Overview : Recombinant fragment corresponding to amino acids 57-261 of Human PNPO with an N terminal His tag; 226 amino acids with tag, Predicted MWt 25.9 kDa.
Description : The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy.
Protein length : 205 amino acids
Conjugation : HIS
Molecular Weight : 25.900kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM PMSF, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Sequence Similarities : Belongs to the pyridoxamine 5-phosphate oxidase family.
Gene Name : PNPO pyridoxamine 5-phosphate oxidase [ Homo sapiens ]
Official Symbol : PNPO
Synonyms : PNPO; pyridoxamine 5-phosphate oxidase; pyridoxine 5 phosphate oxidase; pyridoxine-5-phosphate oxidase; PDXPO;
Gene ID : 55163
mRNA Refseq : NM_018129
Protein Refseq : NP_060599
MIM : 603287
Uniprot ID : Q9NVS9
Chromosome Location : 17q21.32
Pathway : Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Selenium Pathway, organism-specific biosystem;
Function : FMN binding; oxidoreductase activity, acting on the CH-NH2 group of donors; pyridoxamine-phosphate oxidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.