"PPIH" Related Products

Expand
Expand

Recombinant Human PPIH

Cat.No.: PPIH-30106TH
Product Overview: Recombinant full length human PPIH; 177 amino acids, 19.2kDa.
Description: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTA ENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFV NGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM
Sequence Similarities: Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.Contains 1 PPIase cyclophilin-type domain.
Gene Name: PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ]
Official Symbol: PPIH
Synonyms: PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucl
Gene ID: 10465
mRNA Refseq: NM_006347
Protein Refseq: NP_006338
MIM: 606095
Uniprot ID: O43447
Chromosome Location: 1p34.1
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem;
Function: cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.