Recombinant Human PPIH
Cat.No. : | PPIH-30106TH |
Product Overview : | Recombinant full length human PPIH; 177 amino acids, 19.2kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTA ENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFV NGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM |
Sequence Similarities : | Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.Contains 1 PPIase cyclophilin-type domain. |
Gene Name : | PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ] |
Official Symbol : | PPIH |
Synonyms : | PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucl |
Gene ID : | 10465 |
mRNA Refseq : | NM_006347 |
Protein Refseq : | NP_006338 |
MIM : | 606095 |
Uniprot ID : | O43447 |
Chromosome Location : | 1p34.1 |
Pathway : | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem; |
Function : | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding; |
Products Types
◆ Recombinant Protein | ||
Ppih-5043M | Recombinant Mouse Ppih Protein, Myc/DDK-tagged | +Inquiry |
PPIH-3367R | Recombinant Rhesus Macaque PPIH Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIH-30685TH | Recombinant Human PPIH, T7 -tagged | +Inquiry |
PPIH-11421Z | Recombinant Zebrafish PPIH | +Inquiry |
PPIH-1980Z | Recombinant Zebrafish PPIH | +Inquiry |
◆ Lysates | ||
PPIH-2969HCL | Recombinant Human PPIH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket