"PRSS8" Related Products

Expand
Expand

Recombinant Human PRSS8

Cat.No.: PRSS8-30708TH
Product Overview: Recombinant fragment of Human PRSS8 with N-terminal proprietary tag. Predicted MW 36.52kDa.
Description: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGS
Sequence Similarities: Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.
Gene Name: PRSS8 protease, serine, 8 [ Homo sapiens ]
Official Symbol: PRSS8
Synonyms: PRSS8; protease, serine, 8; prostasin;
Gene ID: 5652
mRNA Refseq: NM_002773
Protein Refseq: NP_002764
MIM: 600823
Uniprot ID: Q16651
Chromosome Location: 16p11.2
Function: peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; sodium channel regulator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.