"RCN1" Related Products

Recombinant Human RCN1, His-tagged

Cat.No.: RCN1-31305TH
Product Overview: Recombinant full length Human RCN1 with an N terminal His tag; 341 amino acids including tag, Predicted MWt 40.4kDa.
Description: Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane.
Protein length: 302 amino acids
Conjugation: HIS
Molecular Weight: 40.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Gene Name: RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ]
Official Symbol: RCN1
Synonyms: RCN1; reticulocalbin 1, EF-hand calcium binding domain; RCN; reticulocalbin-1; FLJ37041; PIG20; proliferation inducing gene 20; Rcal;
Gene ID: 5954
mRNA Refseq: NM_002901
Protein Refseq: NP_002892
MIM: 602735
Uniprot ID: Q15293
Chromosome Location: 11p13
Function: calcium ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.