Recombinant Human RCN1, His-tagged

• Cat.No.: RCN1-31305TH
• Product Overview: Recombinant full length Human RCN1 with an N terminal His tag; 341 amino acids including tag, Predicted MWt 40.4kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 302 amino acids
• Description: Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane.
• Conjugation: HIS
• Molecular Weight: 40.400kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Gene Information

• Gene Name: RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ]
• Official Symbol: RCN1
• Synonyms: RCN1; reticulocalbin 1, EF-hand calcium binding domain; RCN; reticulocalbin-1; FLJ37041; PIG20; proliferation inducing gene 20; Rcal
• Gene ID: 5954
• mRNA Refseq: NM_002901
• Protein Refseq: NP_002892
• MIM: 602735
• Uniprot ID: Q15293
• Chromosome Location: 11p13
• Function: calcium ion binding; protein binding