"RGN" Related Products

Expand
Expand

Recombinant Human RGN, His-tagged

Cat.No.: RGN-30488TH
Product Overview: Recombinant full length Human Regucalcin with an N terminal His tag; 319 amino acids with the tag; mwt: 35.4 kDa.
Description: The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5 UTRs, but encoding the same protein.
Protein length: 299 amino acids
Conjugation: HIS
Molecular Weight: 35.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.2% Urea
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG IFKITGLGVKGIAPYSYAG
Sequence Similarities: Belongs to the SMP-30/CGR1 family.
Gene Name: RGN regucalcin (senescence marker protein-30) [ Homo sapiens ]
Official Symbol: RGN
Synonyms: RGN; regucalcin (senescence marker protein-30); regucalcin; RC; senescence marker protein 30; SMP30;
Gene ID: 9104
mRNA Refseq: NM_004683
Protein Refseq: NP_004674
MIM: 300212
Uniprot ID: Q15493
Chromosome Location: Xp11.3
Pathway: Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P =>
Function: calcium ion binding; calcium ion binding; enzyme regulator activity; gluconolactonase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.