"RICTOR" Related Products

Recombinant Human RICTOR

Cat.No.: RICTOR-31328TH
Product Overview: Recombinant fragment corresponding to amino acids 1-98 of Human RICTOR with a proprietary tag at N-terminal ; Predicted MWt 36.41 kDa.
Description: RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Sequence Similarities: Belongs to the pianissimo family.
Gene Name: RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ]
Official Symbol: RICTOR
Synonyms: RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR;
Gene ID: 253260
mRNA Refseq: NM_152756
Protein Refseq: NP_689969
MIM: 609022
Uniprot ID: Q6R327
Chromosome Location: 5p13.1
Pathway: Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem;
Function: protein binding; ribosome binding;
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.