Recombinant Human RICTOR 9 protein, GST-tagged
| Cat.No. : | RICTOR-301236H |
| Product Overview : | Recombinant Human RICTOR 9 (1-51 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Val51 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ] |
| Official Symbol | RICTOR |
| Synonyms | RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR; hAVO3; AVO3 homolog; TORC2-specific protein AVO3; mAVO3; DKFZp686B11164; |
| Gene ID | 253260 |
| mRNA Refseq | NM_152756 |
| Protein Refseq | NP_689969 |
| MIM | 609022 |
| UniProt ID | Q6R327 |
| ◆ Recombinant Proteins | ||
| RICTOR-301236H | Recombinant Human RICTOR 9 protein, GST-tagged | +Inquiry |
| RICTOR-3004H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
| RICTOR-31328TH | Recombinant Human RICTOR | +Inquiry |
| RICTOR-3306H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
| RICTOR-001H | Recombinant Human RPTOR independent companion of MTOR complex 2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RICTOR-1509HCL | Recombinant Human RICTOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RICTOR Products
Required fields are marked with *
My Review for All RICTOR Products
Required fields are marked with *



