Recombinant Human RICTOR 9 protein, GST-tagged
Cat.No. : | RICTOR-301236H |
Product Overview : | Recombinant Human RICTOR 9 (1-51 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val51 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ] |
Official Symbol | RICTOR |
Synonyms | RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR; hAVO3; AVO3 homolog; TORC2-specific protein AVO3; mAVO3; DKFZp686B11164; |
Gene ID | 253260 |
mRNA Refseq | NM_152756 |
Protein Refseq | NP_689969 |
MIM | 609022 |
UniProt ID | Q6R327 |
◆ Recombinant Proteins | ||
RICTOR-3004H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
RICTOR-31328TH | Recombinant Human RICTOR | +Inquiry |
RICTOR-3306H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
RICTOR-001H | Recombinant Human RPTOR independent companion of MTOR complex 2 Protein, His-tagged | +Inquiry |
RICTOR-301236H | Recombinant Human RICTOR 9 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RICTOR-1509HCL | Recombinant Human RICTOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RICTOR Products
Required fields are marked with *
My Review for All RICTOR Products
Required fields are marked with *