Recombinant Human RICTOR

Cat.No. : RICTOR-31328TH
Product Overview : Recombinant fragment corresponding to amino acids 1-98 of Human RICTOR with a proprietary tag at N-terminal ; Predicted MWt 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al.
Molecular Weight : 36.410kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Sequence Similarities : Belongs to the pianissimo family.
Gene Name RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ]
Official Symbol RICTOR
Synonyms RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR;
Gene ID 253260
mRNA Refseq NM_152756
Protein Refseq NP_689969
MIM 609022
Uniprot ID Q6R327
Chromosome Location 5p13.1
Pathway Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem;
Function protein binding; ribosome binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RICTOR Products

Required fields are marked with *

My Review for All RICTOR Products

Required fields are marked with *

0
cart-icon