Recombinant Human RICTOR

• Cat.No.: RICTOR-31328TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-98 of Human RICTOR with a proprietary tag at N-terminal ; Predicted MWt 36.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al.
• Molecular Weight: 36.410kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
• Sequence Similarities: Belongs to the pianissimo family.

Gene Information

• Gene Name: RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ]
• Official Symbol: RICTOR
• Synonyms: RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR
• Gene ID: 253260
• mRNA Refseq: NM_152756
• Protein Refseq: NP_689969
• MIM: 609022
• Uniprot ID: Q6R327
• Chromosome Location: 5p13.1
• Pathway: Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem
• Function: protein binding; ribosome binding