Recombinant Human RICTOR
| Cat.No. : | RICTOR-31328TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 1-98 of Human RICTOR with a proprietary tag at N-terminal ; Predicted MWt 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE |
| Sequence Similarities : | Belongs to the pianissimo family. |
| Gene Name | RICTOR RPTOR independent companion of MTOR, complex 2 [ Homo sapiens ] |
| Official Symbol | RICTOR |
| Synonyms | RICTOR; RPTOR independent companion of MTOR, complex 2; rapamycin-insensitive companion of mTOR; AVO3; KIAA1999; MGC39830; PIA; pianissimo; rapamycin insensitive companion of mTOR; |
| Gene ID | 253260 |
| mRNA Refseq | NM_152756 |
| Protein Refseq | NP_689969 |
| MIM | 609022 |
| Uniprot ID | Q6R327 |
| Chromosome Location | 5p13.1 |
| Pathway | Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; |
| Function | protein binding; ribosome binding; |
| ◆ Recombinant Proteins | ||
| RICTOR-3306H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
| RICTOR-14220M | Recombinant Mouse RICTOR Protein | +Inquiry |
| RICTOR-301236H | Recombinant Human RICTOR 9 protein, GST-tagged | +Inquiry |
| RICTOR-31328TH | Recombinant Human RICTOR | +Inquiry |
| RICTOR-3004H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RICTOR-1509HCL | Recombinant Human RICTOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RICTOR Products
Required fields are marked with *
My Review for All RICTOR Products
Required fields are marked with *
