"SLC26A4" Related Products

Expand
Expand
Expand

Recombinant Human SLC26A4

Cat.No.: SLC26A4-31416TH
Product Overview: Recombinant fragment of Human SLC26A4 with N terminal proprietary tag; Predicted MW 34.54 kDa.
Description: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3 of the SLC26A3 gene. The encoded protein has homology to sulfate transporters.
Protein length: 81 amino acids
Molecular Weight: 34.540kDa inclusive of tags
Source: Wheat germ
Tissue specificity: High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
Sequence Similarities: Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.Contains 1 STAS domain.
Gene Name: SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ]
Official Symbol: SLC26A4
Synonyms: SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS;
Gene ID: 5172
mRNA Refseq: NM_000441
Protein Refseq: NP_000432
MIM: 605646
Uniprot ID: O43511
Chromosome Location: 7q31
Pathway: Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function: chloride transmembrane transporter activity; iodide transmembrane transporter activity; secondary active sulfate transmembrane transporter activity; sulfate transmembrane transporter activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.