Recombinant Human SMAD7
| Cat.No. : | SMAD7-29105TH |
| Product Overview : | Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Tissue specificity : | Ubiquitous with higher expression in the lung and vascular endothelium. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH |
| Sequence Similarities : | Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain. |
| Gene Name | SMAD7 SMAD family member 7 [ Homo sapiens ] |
| Official Symbol | SMAD7 |
| Synonyms | SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7; |
| Gene ID | 4092 |
| mRNA Refseq | NM_001190821 |
| Protein Refseq | NP_001177750 |
| MIM | 602932 |
| Uniprot ID | O15105 |
| Chromosome Location | 18q21.1 |
| Pathway | ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem; |
| Function | I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SMAD7-29105TH | Recombinant Human SMAD7 | +Inquiry |
| SMAD7-5871H | Recombinant Human SMAD7 Protein (Met1-Arg426), N-His tagged | +Inquiry |
| Smad7-5954M | Recombinant Mouse Smad7 Protein, Myc/DDK-tagged | +Inquiry |
| SMAD7-1912H | Recombinant Human SMAD7 Protein, MYC/DDK-tagged | +Inquiry |
| SMAD7-9566Z | Recombinant Zebrafish SMAD7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD7 Products
Required fields are marked with *
My Review for All SMAD7 Products
Required fields are marked with *




