"SMAD7" Related Products

Recombinant Human SMAD7

Cat.No.: SMAD7-29105TH
Product Overview: Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa.
Description: The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene.
Protein length: 101 amino acids
Molecular Weight: 36.740kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous with higher expression in the lung and vascular endothelium.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH
Sequence Similarities: Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain.
Gene Name: SMAD7 SMAD family member 7 [ Homo sapiens ]
Official Symbol: SMAD7
Synonyms: SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7;
Gene ID: 4092
mRNA Refseq: NM_001190821
Protein Refseq: NP_001177750
MIM: 602932
Uniprot ID: O15105
Chromosome Location: 18q21.1
Pathway: ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem;
Function: I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.