Recombinant Human SMAD7
Cat.No. : | SMAD7-29105TH |
Product Overview : | Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 101 amino acids |
Molecular Weight : | 36.740kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Ubiquitous with higher expression in the lung and vascular endothelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH |
Sequence Similarities : | Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain. |
Gene Name : | SMAD7 SMAD family member 7 [ Homo sapiens ] |
Official Symbol : | SMAD7 |
Synonyms : | SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7; |
Gene ID : | 4092 |
mRNA Refseq : | NM_001190821 |
Protein Refseq : | NP_001177750 |
MIM : | 602932 |
Uniprot ID : | O15105 |
Chromosome Location : | 18q21.1 |
Pathway : | ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem; |
Function : | I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
SMAD7-1912H | Recombinant Human SMAD7 Protein, MYC/DDK-tagged | +Inquiry |
Smad7-5954M | Recombinant Mouse Smad7 Protein, Myc/DDK-tagged | +Inquiry |
SMAD7-5269R | Recombinant Rat SMAD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMAD7-2705H | Recombinant Human SMAD7 Protein, His-tagged | +Inquiry |
SMAD7-2043H | Recombinant Human SMAD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket