Recombinant Human SMAD7
Cat.No. : | SMAD7-29105TH |
Product Overview : | Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.740kDa inclusive of tags |
Tissue specificity : | Ubiquitous with higher expression in the lung and vascular endothelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH |
Sequence Similarities : | Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain. |
Gene Name | SMAD7 SMAD family member 7 [ Homo sapiens ] |
Official Symbol | SMAD7 |
Synonyms | SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7; |
Gene ID | 4092 |
mRNA Refseq | NM_001190821 |
Protein Refseq | NP_001177750 |
MIM | 602932 |
Uniprot ID | O15105 |
Chromosome Location | 18q21.1 |
Pathway | ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem; |
Function | I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding; |
◆ Recombinant Proteins | ||
SMAD7-29105TH | Recombinant Human SMAD7 | +Inquiry |
Smad7-5954M | Recombinant Mouse Smad7 Protein, Myc/DDK-tagged | +Inquiry |
SMAD7-241HFL | Recombinant Full Length Human SMAD7 Protein, C-Flag-tagged | +Inquiry |
SMAD7-5269R | Recombinant Rat SMAD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMAD7-561H | Recombinant Human SMAD7 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMAD7 Products
Required fields are marked with *
My Review for All SMAD7 Products
Required fields are marked with *
0
Inquiry Basket