Recombinant Human SMAD7

• Cat.No.: SMAD7-29105TH
• Product Overview: Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa.

Specification

• Description: The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene.
• Protein length: 101 amino acids
• Molecular Weight: 36.740kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Ubiquitous with higher expression in the lung and vascular endothelium.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH
• Sequence Similarities: Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain.

Gene Information

• Gene Name: SMAD7 SMAD family member 7 [ Homo sapiens ]
• Official Symbol: SMAD7
• Synonyms: SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7
• Gene ID: 4092
• mRNA Refseq: NM_001190821
• Protein Refseq: NP_001177750
• MIM: 602932
• Uniprot ID: O15105
• Chromosome Location: 18q21.1
• Pathway: ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem
• Function: I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding