"SMPD1" Related Products

Expand
Expand

Recombinant Human SMPD1

Cat.No.: SMPD1-26292TH
Product Overview: Recombinant fragment of Human Acid sphingomyelinase with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.
Description: The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF
Sequence Similarities: Belongs to the acid sphingomyelinase family.Contains 1 saposin B-type domain.
Gene Name: SMPD1 sphingomyelin phosphodiesterase 1, acid lysosomal [ Homo sapiens ]
Official Symbol: SMPD1
Synonyms: SMPD1; sphingomyelin phosphodiesterase 1, acid lysosomal; sphingomyelin phosphodiesterase; acid sphingomyelinase; ASM;
Gene ID: 6609
mRNA Refseq: NM_000543
Protein Refseq: NP_000534
MIM: 607608
Uniprot ID: P17405
Chromosome Location: 11p15.4-p15.1
Pathway: Ceramide signaling pathway, organism-specific biosystem; FAS (CD95) signaling pathway, organism-specific biosystem; IL2 signaling events mediated by PI3K, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function: hydrolase activity, acting on glycosyl bonds; sphingomyelin phosphodiesterase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.