"SOX10" Related Products

Expand
Expand

Recombinant Human SOX10

Cat.No.: SOX10-29273TH
Product Overview: Recombinant fragment of Human SOX10 with N terminal proprietary tag, 36.41kDa inclusive of tag.
Description: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in fetal brain and in adult brain, heart, small intestine and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Sequence Similarities: Contains 1 HMG box DNA-binding domain.
Gene Name: SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ]
Official Symbol: SOX10
Synonyms: SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4;
Gene ID: 6663
mRNA Refseq: NM_006941
Protein Refseq: NP_008872
MIM: 602229
Uniprot ID: P56693
Chromosome Location: 22q13.1
Function: DNA binding; chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.