Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human STAT6, His-tagged

Cat.No. : STAT6-30854TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-287 of Human STAT6 with N terminal His tag; 287 amino acids, 33kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 147 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWE FLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTIL QHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRH LPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAE AGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAK ALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLV DIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVT SCFLVEKQPPQVLKTQT
Sequence Similarities : Belongs to the transcription factor STAT family.Contains 1 SH2 domain.
Gene Name : STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ]
Official Symbol : STAT6
Synonyms : STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT;
Gene ID : 6778
mRNA Refseq : NM_001178078
Protein Refseq : NP_001171549
MIM : 601512
Uniprot ID : P42226
Chromosome Location : 12q13
Pathway : Adipogenesis, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem;
Function : calcium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends