Recombinant Human TF

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TF

Recombinant Human TF

TF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TF-31155TH
Product Overview : Recombinant full length Human Transferrin expressed in modified human 293 cells, 70-80kDa.
Description : This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.
Tissue specificity : Expressed by the liver and secreted in plasma.
Biological activity : The activity of TF-31155TH was measured by its ability to support the growth of HepG2 cells under conditions of reduced serum. Typically 0.1 to 1 μg enhances cell proliferation.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Shipped at 4°C. After reconstitution store at -20oC. Avoid freeze / thaw cycles.
Sequences of amino acids : Theoretical sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVA CVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNN LKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRG KKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVAN FFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSG AFKCLKNGAGDVAFVKHSTIFENLANKADRDQYELLCL DNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLN QAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVP PRMDAKMYLGYEYVTAIRNLREGTCQEAPTDECKPVKW CALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIM NGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCED TPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTA GWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCK LCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQ TVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEY ANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNV TDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKY LGEEYVKAVGNLRKCSTSSLLEACTFRRP
Sequence Similarities : Belongs to the transferrin family.Contains 2 transferrin-like domains.
Gene Name : TF transferrin [ Homo sapiens ]
Official Symbol : TF
Synonyms : TF; transferrin; serotransferrin; PRO1557; PRO2086;
Gene ID : 7018
mRNA Refseq : NM_001063
Protein Refseq : NP_001054
MIM : 190000
Uniprot ID : P02787
Chromosome Location : 3q21
Pathway : EPHB forward signaling, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hemostasis, organism-specific biosystem; Iron uptake and transport, organism-specific biosystem; Mineral absorption, organism-specific biosystem;
Function : ferric iron binding; metal ion binding; protein binding; ubiquitin protein ligase binding;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2022 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy