Recombinant Human USP20, His-tagged USP20-29613TH

Recombinant Human USP20, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human USP20, His-tagged

Recombinant Human USP20, His-tagged

USP20 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : USP20-29613TH
Product Overview : Recombinant fragment, corresponding to amino acids 608-914 of Human USP20 with N terminal His tag; MWt 36 kDa.
Description : Ubiquitin carboxyl-terminal hydrolase 20 is an enzyme that in humans is encoded by the USP20 gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAY CQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKS SEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTF AEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEH LYNRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTF IKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEP PGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLN SLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAETRAV
Sequence Similarities : Belongs to the peptidase C19 family. USP20/USP33 subfamily.Contains 2 DUSP domains.Contains 1 UBP-type zinc finger.
Gene Name : USP20 ubiquitin specific peptidase 20 [ Homo sapiens ]
Official Symbol : USP20
Synonyms : USP20; ubiquitin specific peptidase 20; ubiquitin specific protease 20; ubiquitin carboxyl-terminal hydrolase 20; KIAA1003;
Gene ID : 10868
mRNA Refseq : NM_001008563
Protein Refseq : NP_001008563
Uniprot ID : Q9Y2K6
Chromosome Location : 9q34.2
Function : G-protein coupled receptor binding; cysteine-type endopeptidase activity; metal ion binding; peptidase activity; ubiquitin thiolesterase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy