Recombinant Human USP20, His-tagged
Cat.No. : | USP20-29613TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 608-914 of Human USP20 with N terminal His tag; MWt 36 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 608-914 a.a. |
Description : | Ubiquitin carboxyl-terminal hydrolase 20 is an enzyme that in humans is encoded by the USP20 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAY CQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKS SEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTF AEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEH LYNRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTF IKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEP PGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLN SLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAETRAV |
Sequence Similarities : | Belongs to the peptidase C19 family. USP20/USP33 subfamily.Contains 2 DUSP domains.Contains 1 UBP-type zinc finger. |
Gene Name | USP20 ubiquitin specific peptidase 20 [ Homo sapiens ] |
Official Symbol | USP20 |
Synonyms | USP20; ubiquitin specific peptidase 20; ubiquitin specific protease 20; ubiquitin carboxyl-terminal hydrolase 20; KIAA1003; |
Gene ID | 10868 |
mRNA Refseq | NM_001008563 |
Protein Refseq | NP_001008563 |
Uniprot ID | Q9Y2K6 |
Chromosome Location | 9q34.2 |
Function | G-protein coupled receptor binding; cysteine-type endopeptidase activity; metal ion binding; peptidase activity; ubiquitin thiolesterase activity; |
◆ Recombinant Proteins | ||
USP20-2323H | Recombinant Human USP20 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP20-17910M | Recombinant Mouse USP20 Protein | +Inquiry |
USP20-9952M | Recombinant Mouse USP20 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP20-3621H | Recombinant Human USP20, GST-tagged | +Inquiry |
USP20-787HFL | Active Recombinant Full Length Human USP20 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP20-466HCL | Recombinant Human USP20 293 Cell Lysate | +Inquiry |
USP20-467HCL | Recombinant Human USP20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP20 Products
Required fields are marked with *
My Review for All USP20 Products
Required fields are marked with *