Recombinant Human USP20, His-tagged
| Cat.No. : | USP20-29613TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 608-914 of Human USP20 with N terminal His tag; MWt 36 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 608-914 a.a. |
| Description : | Ubiquitin carboxyl-terminal hydrolase 20 is an enzyme that in humans is encoded by the USP20 gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAY CQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKS SEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTF AEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEH LYNRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTF IKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEP PGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLN SLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAETRAV |
| Sequence Similarities : | Belongs to the peptidase C19 family. USP20/USP33 subfamily.Contains 2 DUSP domains.Contains 1 UBP-type zinc finger. |
| Gene Name | USP20 ubiquitin specific peptidase 20 [ Homo sapiens ] |
| Official Symbol | USP20 |
| Synonyms | USP20; ubiquitin specific peptidase 20; ubiquitin specific protease 20; ubiquitin carboxyl-terminal hydrolase 20; KIAA1003; |
| Gene ID | 10868 |
| mRNA Refseq | NM_001008563 |
| Protein Refseq | NP_001008563 |
| Uniprot ID | Q9Y2K6 |
| Chromosome Location | 9q34.2 |
| Function | G-protein coupled receptor binding; cysteine-type endopeptidase activity; metal ion binding; peptidase activity; ubiquitin thiolesterase activity; |
| ◆ Recombinant Proteins | ||
| USP20-162H | Active Recombinant Human USP20, GST-tagged | +Inquiry |
| USP20-0364H | Recombinant Human USP20 Protein (K120-V914), GST tagged | +Inquiry |
| USP20-0363H | Recombinant Human USP20 Protein (K120-V914), Tag Free | +Inquiry |
| USP20-29613TH | Recombinant Human USP20, His-tagged | +Inquiry |
| USP20-17910M | Recombinant Mouse USP20 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP20-467HCL | Recombinant Human USP20 293 Cell Lysate | +Inquiry |
| USP20-466HCL | Recombinant Human USP20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP20 Products
Required fields are marked with *
My Review for All USP20 Products
Required fields are marked with *
