"VEGFC" Related Products

Expand
Expand

Recombinant Human VEGFC, Fc-tagged

Cat.No.: VEGFC-31451TH
Product Overview: Recombinant full length human VEGFC expressed in modified human 293 cells; secreted disulfide linked antiparallel homodimer; 45-55kDa.
Description: The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels.This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-3 receptors. Only the fully processed form can bind and activate VEGFR-2 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor D.
Conjugation: Fc
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: TheoreticalSequence:FESGLDLSDAEPDAGEAT AYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRK GGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGC CNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISF ANHTSCRCMSKLDVYRQVHSIIRRDisulfide bonded to:SLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDF MFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENT CQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKF HHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMSNote: N-terminal sequences confirmed by Edman sequencing.
Gene Name: VEGFC vascular endothelial growth factor C [ Homo sapiens ]
Official Symbol: VEGFC
Synonyms: VEGFC; vascular endothelial growth factor C; VRP;
Gene ID: 7424
mRNA Refseq: NM_005429
Protein Refseq: NP_005420
MIM: 601528
Uniprot ID: P49767
Chromosome Location: 4q34.3
Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem;
Function: chemoattractant activity; growth factor activity; protein binding; vascular endothelial growth factor receptor 3 binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.