Recombinant Human WD Repeat Domain 4 Protein, T7 tagged

• Cat.No.: WDR4-847H
• Product Overview: Recombinant Human WD Repeat Domain 4 Protein (1-266 aa) with T7 tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 1-266 aa
• Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 30 kDa
• AA Sequence: MASMTGGQQMGMAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTP
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 50mM Tris, pH8.5, 300mM NaCl, 10 % Glycerol
• Concentration: 1 mg/mL by Bradford

Gene Information

• Gene Name: WDR4 WD repeat domain 4 [ Homo sapiens (human) ]
• Official Symbol: WDR4
• Synonyms: WDR4; WD repeat domain 4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; TRM82; WD repeat-containing protein 4
• Gene ID: 10785
• mRNA Refseq: NM_018669
• Protein Refseq: NP_061139
• MIM: 605924
• UniProt ID: P57081