Recombinant Human WD Repeat Domain 4 Protein, T7 tagged
Cat.No. : | WDR4-847H |
Product Overview : | Recombinant Human WD Repeat Domain 4 Protein (1-266 aa) with T7 tag was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 1-266 aa |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 30 kDa |
AA Sequence : | MASMTGGQQMGMAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTP |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, pH8.5, 300mM NaCl, 10 % Glycerol |
Concentration : | 1 mg/mL by Bradford |
Gene Name | WDR4 WD repeat domain 4 [ Homo sapiens (human) ] |
Official Symbol | WDR4 |
Synonyms | WDR4; WD repeat domain 4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; TRM82; WD repeat-containing protein 4 |
Gene ID | 10785 |
mRNA Refseq | NM_018669 |
Protein Refseq | NP_061139 |
MIM | 605924 |
UniProt ID | P57081 |
◆ Recombinant Proteins | ||
WDR4-10HFL | Recombinant Full Length Human WD repeat domain 4 Protein, Flag tagged | +Inquiry |
Wdr4-6979M | Recombinant Mouse Wdr4 Protein, Myc/DDK-tagged | +Inquiry |
WDR4-6738Z | Recombinant Zebrafish WDR4 | +Inquiry |
WDR4-847H | Recombinant Human WD Repeat Domain 4 Protein, T7 tagged | +Inquiry |
◆ Native Proteins | ||
WDR4-02HFL | Recombinant Full Length Human WDR4 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR4-348HCL | Recombinant Human WDR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR4 Products
Required fields are marked with *
My Review for All WDR4 Products
Required fields are marked with *