Recombinant Human WD Repeat Domain 4 Protein, T7 tagged

Cat.No. : WDR4-847H
Product Overview : Recombinant Human WD Repeat Domain 4 Protein (1-266 aa) with T7 tag was expressed in E. coli.
Availability October 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 1-266 aa
Description : This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 30 kDa
AA Sequence : MASMTGGQQMGMAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTP
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile 50mM Tris, pH8.5, 300mM NaCl, 10 % Glycerol
Concentration : 1 mg/mL by Bradford
Gene Name WDR4 WD repeat domain 4 [ Homo sapiens (human) ]
Official Symbol WDR4
Synonyms WDR4; WD repeat domain 4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; TRM82; WD repeat-containing protein 4
Gene ID 10785
mRNA Refseq NM_018669
Protein Refseq NP_061139
MIM 605924
UniProt ID P57081

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDR4 Products

Required fields are marked with *

My Review for All WDR4 Products

Required fields are marked with *

0
cart-icon
0
compare icon