GMP Recombinant Human IL15 protein
Cat.No. : | IL15-4329HG |
Product Overview : | Recombinant Human IL15 protein was expressed in Escherichia coli. This product is produced under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 114 |
Description : | Human Interleukin-15 (IL-15) is expressed by the IL15 gene located on the chromosome 4. It shares approximately 97 % and 73 % sequence identity with simian and murine IL-15, respectively. Both human and simian IL-15 are active on murine cells. IL-15 is secreted by mononuclear phagocytes (and some other cells), especially macrophages following infection by virus. It possesses a variety of biological functions, including stimulating and maintaining of cellular immune responses, especially regulating T and natural killer (NK) cell activation and proliferation. In additionally, it shares many biological properties with IL-2, including T, B and NK cell-stimulatory activities. IL-15 signals through a complex composed of IL-2/IL-15 receptor beta chain. Although IL-15 lacks sequence homology with IL-2, it has recently been shown that both the beta and gamma chains of the IL-2 receptor are utilized for IL-15 binding and signaling. In addition, an IL-15 specific binding protein has also been cloned from a mouse T cell clone. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 12.9 kDa, a single non-glycosylated polypeptide chain containing 114 amino acids. |
AA Sequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Endotoxin : | Less than 0.01 EU/µg of rHuIL-15 GMP as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL15 |
Official Symbol | IL15 |
Synonyms | IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15; |
Gene ID | 3600 |
mRNA Refseq | NM_000585 |
Protein Refseq | NP_000576 |
MIM | 600554 |
UniProt ID | P40933 |
◆ Recombinant Proteins | ||
Il15-739M | Active Recombinant Mouse Interleukin 15, His-tagged | +Inquiry |
IL15-80P | Recombinant Porcine Interleukin-15 | +Inquiry |
IL15-0176H | Active Recombinant Human IL15 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL15-006H | Active Recombinant Human IL15, HIgG1 Fc-tagged | +Inquiry |
IL15-271H | Active Recombinant Human IL15 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
0
Inquiry Basket