"IL15" Related Products

Expand
Expand
Expand

GMP Recombinant Human IL15 protein

Cat.No.: IL15-4329HG
Product Overview: Recombinant Human IL15 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: Human Interleukin-15 (IL-15) is expressed by the IL15 gene located on the chromosome 4. It shares approximately 97 % and 73 % sequence identity with simian and murine IL-15, respectively. Both human and simian IL-15 are active on murine cells. IL-15 is secreted by mononuclear phagocytes (and some other cells), especially macrophages following infection by virus. It possesses a variety of biological functions, including stimulating and maintaining of cellular immune responses, especially regulating T and natural killer (NK) cell activation and proliferation. In additionally, it shares many biological properties with IL-2, including T, B and NK cell-stimulatory activities. IL-15 signals through a complex composed of IL-2/IL-15 receptor beta chain. Although IL-15 lacks sequence homology with IL-2, it has recently been shown that both the beta and gamma chains of the IL-2 receptor are utilized for IL-15 binding and signaling. In addition, an IL-15 specific binding protein has also been cloned from a mouse T cell clone.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10^6 IU/mg.
Molecular Mass: Approximately 12.9 kDa, a single non-glycosylated polypeptide chain containing 114 amino acids.
AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin: Less than 1 EU/µg of rHuIL-15 as determined by LAL method.
Purity: > 97 % by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL15 interleukin 15 [ Homo sapiens ]
Official Symbol: IL15
Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID: 3600
mRNA Refseq: NM_000585
Protein Refseq: NP_000576
MIM: 600554
UniProt ID: P40933

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.