GMP Recombinant Mouse Gdnf Protein, His-Tagged
Cat.No. : | Gdnf-01M |
Product Overview : | Recombinant Mouse Gdnf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Homozygous knockout mice for this gene exhibit defects in kidney development and neonatal death. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. |
Form : | Lyophilized |
AA Sequence : | MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRR LTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ] |
Official Symbol | Gdnf |
Synonyms | ATF |
Gene ID | 14573 |
mRNA Refseq | NM_001301332.1 |
Protein Refseq | NP_001288261.1 |
UniProt ID | P48540 |
◆ Recombinant Proteins | ||
GDNF-1066C | Recombinant Canine GDNF protein, hFc-tagged | +Inquiry |
GDNF-108H | Recombinant Active Human GDNF Protein, His-tagged(C-ter) | +Inquiry |
GDNF-279G | Active Recombinant Human GDNF Protein | +Inquiry |
GDNF-03HG | GMP Recombinant Human GDNF protein, For Organoid Culture | +Inquiry |
GDNF-7293H | Recombinant Human GDNF protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gdnf Products
Required fields are marked with *
My Review for All Gdnf Products
Required fields are marked with *
0
Inquiry Basket