GMP Recombinant Mouse Mdk Protein, His-Tagged
Cat.No. : | Mdk-01M |
Product Overview : | GMP Recombinant Mouse Mdk Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a secreted growth factor that belongs to the pleiotrophin/midkine heparin-binding protein family and functions in a variety of biological processes. The encoded cytokine promotes the growth, differentiation, survival and migration of several target cells including leucocytes involved in inflammation. This protein plays a role in the formation of scar tissue and intraperitoneal adhesions, and promotes neurite outgrowth and neuron survival. The protein encoded by this gene is associated with obesity and inhibition of insulin signaling in fat cells. A pseudogene of this gene is present on chromosome 11. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
AA Sequence : | MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Mdk midkine [ Mus musculus (house mouse) ] |
Official Symbol | Mdk |
Synonyms | MK; Mek |
Gene ID | 17242 |
mRNA Refseq | NM_001012335.2 |
Protein Refseq | NP_001012335.1 |
UniProt ID | P12025 |
◆ Recombinant Proteins | ||
MDK-3799C | Recombinant Chicken MDK | +Inquiry |
MDK-30202TH | Recombinant Human MDK | +Inquiry |
MDK-5862H | Recombinant Human MDK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MDK-236H | Recombinant Active Human MDK Protein, Tag Free | +Inquiry |
MDK-5931H | Recombinant Human MDK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mdk Products
Required fields are marked with *
My Review for All Mdk Products
Required fields are marked with *
0
Inquiry Basket