GMP Recombinant Porcine CXCL9 Protein, His-Tagged

Cat.No. : CXCL9-01P
Product Overview : GMP Recombinant Porcine CXCL9 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : CXCL9, also named Monokine, is a member of the CXC chemokine family and is induced by gamma interferon (MIG). Following induced by IFN-gamma, this chemokine can attract T-cells . CXCL9 has close relationship with two other CXC chemokines named CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is also a cytokine that affects the growth, movement, or activation state of cells participating in immune and inflammatory response and work as a chemoattractant of activated T-cells.
Form : Lyophilized
AA Sequence : TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name CXCL9 C-X-C motif chemokine ligand 9 [ Sus scrofa (pig) ]
Official Symbol CXCL9
Synonyms MIG
Gene ID 100135681
mRNA Refseq NM_001114289.2
Protein Refseq NP_001107761.2
UniProt ID A0A4X1SX95

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL9 Products

Required fields are marked with *

My Review for All CXCL9 Products

Required fields are marked with *

0
cart-icon
0
compare icon