Recombinant Human CXCL9 Protein, GST-tagged
| Cat.No. : | CXCL9-2175H |
| Product Overview : | Human CXCL9 full-length ORF ( AAH63122, 23 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ] |
| Official Symbol | CXCL9 |
| Synonyms | CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10; |
| Gene ID | 4283 |
| mRNA Refseq | NM_002416 |
| Protein Refseq | NP_002407 |
| MIM | 601704 |
| UniProt ID | Q07325 |
| ◆ Recombinant Proteins | ||
| CXCL9-4395C | Recombinant Cynomolgus Monkey CXCL9 Protein | +Inquiry |
| CXCL9-937R | Recombinant Rhesus Macaque CXCL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CXCL9-346H | Active Recombinant Mouse Chemokine (C-X-C Motif) Ligand 9, HIgG1 Fc-tagged | +Inquiry |
| CXCL9-73M | Recombinant Mouse CXCL9 (MIG) | +Inquiry |
| CXCL9-2761H | Recombinant Human CXCL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL9 Products
Required fields are marked with *
My Review for All CXCL9 Products
Required fields are marked with *
