"CXCL9" Related Products

Expand
Expand
Expand

Recombinant Human CXCL9 Protein, GST-tagged

Cat.No. : CXCL9-2175H
Product Overview : Human CXCL9 full-length ORF ( AAH63122, 23 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.07 kDa
AA Sequence : TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ]
Official Symbol : CXCL9
Synonyms : CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10;
Gene ID : 4283
mRNA Refseq : NM_002416
Protein Refseq : NP_002407
MIM : 601704
UniProt ID : Q07325

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.