Recombinant Active Human BDNF Protein, His-tagged
Cat.No. : | BDNF-01H |
Product Overview : | Recombinant active human BDNF protein fused with a His-tagged (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is < 2 ng/mL. |
AA Sequence : | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Endotoxin : | Less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20 centigrade. After reconstitution, aliquot and store at -20 or -80 centigrade for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BDNF brain derived neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain derived neurotrophic factor; ANON2; BULN2; brain-derived neurotrophic factor; abrineurin; neurotrophin |
Gene ID | 627 |
mRNA Refseq | NM_170735 |
Protein Refseq | NP_733931 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-312H | Recombinant Human BDNF Protein, His-tagged | +Inquiry |
BDNF-3372H | Recombinant Human BDNF protein, His-tagged | +Inquiry |
BDNF-22H | Recombinant Human BDNF Protein, His-tagged | +Inquiry |
BDNF-966R | Recombinant Rat BDNF Protein | +Inquiry |
BDNF-311C | Recombinant Cattle BDNF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket