Recombinant Active Human FGF3 Protein, His-tagged(C-ter)

Cat.No. : FGF3-84H
Product Overview : Recombinant Active Human FGF3 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 78 ng/mL.
AA Sequence : MDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name FGF3 fibroblast growth factor 3 [ Homo sapiens ]
Official Symbol FGF3
Synonyms FGF3; fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v int 2) oncogene homolog) , INT2; HBGF 3; INT 2 proto oncogene protein; murine mammary tumor virus integration site 2; mouse; oncogene INT2; V INT2 murine mammary tumor virus integration site oncogene homolog; FGF-3; proto-oncogene Int-2; INT-2 proto-oncogene protein; heparin-binding growth factor 3; murine mammary tumor virus integration site 2, mouse; V-INT2 murine mammary tumor virus integration site oncogene homolog; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); INT2; HBGF-3;
Gene ID 2248
mRNA Refseq NM_005247
Protein Refseq NP_005238
MIM 164950
UniProt ID P11487

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF3 Products

Required fields are marked with *

My Review for All FGF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon