Recombinant Active Human GDF6 Protein, His-tagged(C-ter)
Cat.No. : | GDF6-106H |
Product Overview : | Recombinant Active Human GDF6 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 63-240 ng/mL. |
AA Sequence : | MTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | GDF6 growth differentiation factor 6 [ Homo sapiens ] |
Official Symbol | GDF6 |
Synonyms | GDF6; growth differentiation factor 6; growth/differentiation factor 6; BMP13; GDF-6; Klippel-Feil syndrome; Klip-Feil malformation; Klippel-Feil malformation; growth/differentiation factor 16; KFM; KFS; KFS1; KFSL; SGM1; CDMP2; MCOP4; SCDO4; MCOPCB6; MGC158100; MGC158101; |
Gene ID | 392255 |
mRNA Refseq | NM_001001557 |
Protein Refseq | NP_001001557 |
MIM | 601147 |
UniProt ID | Q6KF10 |
◆ Recombinant Proteins | ||
GDF6-188H | Active Recombinant Human GDF6 Protein (Thr336-Arg455), C-His tagged, Animal-free, Carrier-free | +Inquiry |
GDF6-3027H | Recombinant Human GDF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF6-2503R | Recombinant Rat GDF6 Protein | +Inquiry |
GDF6-381H | Recombinant Human GDF6 protein | +Inquiry |
Gdf6-722M | Active Recombinant Mouse Growth Differentiation Factor 6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF6-5967HCL | Recombinant Human GDF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF6 Products
Required fields are marked with *
My Review for All GDF6 Products
Required fields are marked with *
0
Inquiry Basket