Recombinant Active Human IL11 Protein, His-tagged(N-ter)
Cat.No. : | IL11-137H |
Product Overview : | Recombinant Active Human IL11 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2012] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce T11 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately > 1 x 10^7 IU/mg. |
AA Sequence : | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL11 interleukin 11 [ Homo sapiens ] |
Official Symbol | IL11 |
Synonyms | IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11; |
Gene ID | 3589 |
mRNA Refseq | NM_000641 |
Protein Refseq | NP_000632 |
MIM | 147681 |
UniProt ID | P20809 |
◆ Recombinant Proteins | ||
IL11-2519H | Recombinant Human IL11 Protein (Pro22-Leu199), His tagged | +Inquiry |
IL11-175H | Active Recombinant Human IL11 Protein (Pro22-Leu199), N-His tagged, Animal-free, Carrier-free | +Inquiry |
IL11-464H | Recombinant Human IL11 protein(Pro22-Leu199) | +Inquiry |
IL11-938C | Recombinant Cynomogus IL11 Protein | +Inquiry |
Il11-4756R | Recombinant Rat Il11 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL11 Products
Required fields are marked with *
My Review for All IL11 Products
Required fields are marked with *
0
Inquiry Basket