Recombinant Active Human IL13 Protein, His-tagged(C-ter)

Cat.No. : IL13-143H
Product Overview : Recombinant Active Human IL13 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.8 ng/mL. The specific activity of recombinant human IL-13 is approximately > 1 x 10^6 IU/mg.
AA Sequence : MSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IL13 interleukin 13 [ Homo sapiens ]
Official Symbol IL13
Synonyms IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13;
Gene ID 3596
mRNA Refseq NM_002188
Protein Refseq NP_002179
MIM 147683
UniProt ID P35225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13 Products

Required fields are marked with *

My Review for All IL13 Products

Required fields are marked with *

0
cart-icon
0
compare icon