Recombinant Active Human IL36B Protein, His-tagged(C-ter)
Cat.No. : | IL36B-197H |
Product Overview : | Recombinant Active Human IL36B Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 0.2 ng/mL. |
AA Sequence : | MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL36B interleukin 36, beta [ Homo sapiens ] |
Official Symbol | IL36B |
Synonyms | IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA); |
Gene ID | 27177 |
mRNA Refseq | NM_014438 |
Protein Refseq | NP_055253 |
MIM | 605508 |
UniProt ID | Q9NZH7 |
◆ Recombinant Proteins | ||
IL36B-7519H | Recombinant Human IL36B protein, His-tagged | +Inquiry |
IL36B-123H | Active Recombinant Human IL36B Protein (Arg5-Glu157), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il1f8-647M | Recombinant Mouse Il1f8 protein | +Inquiry |
IL36B-140H | Active Recombinant Human IL36B protein | +Inquiry |
Il36b-3507M | Recombinant Mouse Il36b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36B-5236HCL | Recombinant Human IL1F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36B Products
Required fields are marked with *
My Review for All IL36B Products
Required fields are marked with *