Recombinant Mouse Il1f8 protein
| Cat.No. : | Il1f8-646M |
| Product Overview : | Recombinant Mouse Il1f8 protein (Ser31-Lys183) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 153 |
| Description : | Interleukin-36 is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36 beta is reported to be expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin and it can stimulate production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. IL-36 beta has two isoforms. IL-36β2 contains one potential N-linked glycosylation site in its C-terminus, while IL -36β isoform 1 lacks potential N-linked glycosylation sites and four of the conserved β-strands. Within the IL-1 family, IL-36β/IL-1F8 shares 30 %, 32 %, 37 %, 46 %, 34 %, 45 % and 28 % a.a. sequence identity with IL-1 ra, IL-1β, IL-36Ra/IL-1F5, IL-36α/IL-1F6, IL-37/IL-1F7, IL-36γ/IL-1F9 and IL-1F10, respectively. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5% trehalose. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
| Molecular Mass : | Approximately 17.4 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| AA Sequence : | SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK |
| Endotoxin : | Less than 1 EU/µg of rMuIL-36β, 153a.a. as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Il1f8 |
| Official Symbol | Il1f8 |
| Synonyms | IL1F8; interleukin 1 family, member 8; interleukin-36 beta; IL-1F8; interleukin-1 family member 8; Il36b; 2310043N20Rik; |
| Gene ID | 69677 |
| mRNA Refseq | NM_027163 |
| Protein Refseq | NP_081439 |
| UniProt ID | Q9D6Z6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36B Products
Required fields are marked with *
My Review for All IL36B Products
Required fields are marked with *



