Recombinant Active Mouse CSF2 Protein, His-tagged(N-ter)

Cat.No. : Csf2-49M
Product Overview : Recombinant Active Mouse CSF2 Protein with His tag (N-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is < 50 pg/ml. The specific activity of recombinant mouse GM-CSF is approximately > 2x 10^7 IU/mg.
AA Sequence : APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus ]
Official Symbol Csf2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; put. GM-CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; Csfgm; GMCSF; Gm-CSf; MGI-IGM; MGC151255; MGC151257;
Gene ID 12981
mRNA Refseq NM_009969
Protein Refseq NP_034099

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0
cart-icon