Recombinant Active Mouse IL18 Protein, His-tagged(C-ter)
Cat.No. : | Il18-155M |
Product Overview : | Recombinant Active Mouse IL18 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a proinflammatory cytokine that augments natural killer cell activity in spleen cells, and stimulates interferon gamma production in T-helper type I cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2011] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is < 0.5 μg/mL. |
AA Sequence : | MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il18 interleukin 18 [ Mus musculus ] |
Official Symbol | Il18 |
Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Igif; Il-18; |
Gene ID | 16173 |
mRNA Refseq | NM_008360 |
Protein Refseq | NP_032386 |
◆ Recombinant Proteins | ||
Il18-7564M | Recombinant Mouse Il18 protein, His-tagged | +Inquiry |
IL18-876P | Recombinant Pig IL18 protein, His & T7-tagged | +Inquiry |
IL18-873C | Recombinant Cattle IL18 protein, His & T7-tagged | +Inquiry |
IL18-94H | Recombinant Human IL18 Protein, His-tagged | +Inquiry |
IL18-83M | Recombinant Mouse IL-18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All IL18 Products
Required fields are marked with *
My Review for All IL18 Products
Required fields are marked with *