Recombinant Active Mouse TNFSF13B Protein, His-tagged(C-ter)
Cat.No. : | Tnfsf13b-320M |
Product Overview : | Recombinant Active Mouse TNFSF13B Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in mouse B cells. The ED50 for this effect is < 0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10^6 IU/mg. |
AA Sequence : | MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Tnfsf13b tumor necrosis factor (ligand) superfamily, member 13b [ Mus musculus ] |
Official Symbol | Tnfsf13b |
Synonyms | TNFSF13B; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor ligand superfamily member 13B; B-cell-activating factor; b cell-activating factor; BAFF; BLyS; TALL1; THANK; zTNF4; TALL-1; TNFSF20; D8Ertd387e; MGC124060; MGC124061; |
Gene ID | 24099 |
mRNA Refseq | NM_033622 |
Protein Refseq | NP_296371 |
◆ Recombinant Proteins | ||
TNFSF13B-0731H | Recombinant Human TNFSF13B Protein (Ala134-Leu285), C-His tagged | +Inquiry |
TNFSF13B-137CB | Active Recombinant Cynomolgus TNFSF13B protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFSF13B-137C | Active Recombinant Cynomolgus TNFSF13B protein, His-Avi-tagged | +Inquiry |
Tnfsf13b-411M | Recombinant Mouse Tnfsf13b, FLAG-tagged | +Inquiry |
TNFSF13B-24H | Active Recombinant Human TNFSF13B Protein, N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF13B-2025HCL | Recombinant Human TNFSF13B cell lysate | +Inquiry |
TNFSF13B-1014CCL | Recombinant Cynomolgus TNFSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF13B Products
Required fields are marked with *
My Review for All TNFSF13B Products
Required fields are marked with *
0
Inquiry Basket