Recombinant Active Mouse TNFSF13B Protein, His-tagged(C-ter)

Cat.No. : Tnfsf13b-320M
Product Overview : Recombinant Active Mouse TNFSF13B Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in mouse B cells. The ED50 for this effect is < 0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10^6 IU/mg.
AA Sequence : MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Tnfsf13b tumor necrosis factor (ligand) superfamily, member 13b [ Mus musculus ]
Official Symbol Tnfsf13b
Synonyms TNFSF13B; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor ligand superfamily member 13B; B-cell-activating factor; b cell-activating factor; BAFF; BLyS; TALL1; THANK; zTNF4; TALL-1; TNFSF20; D8Ertd387e; MGC124060; MGC124061;
Gene ID 24099
mRNA Refseq NM_033622
Protein Refseq NP_296371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF13B Products

Required fields are marked with *

My Review for All TNFSF13B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon