Recombinant Apple MALD1 Protein (2-159 aa), His-SUMO-tagged
| Cat.No. : | MALD1-1992A |
| Product Overview : | Recombinant Apple (Malus domestica) (Pyrus malus) MALD1 Protein (2-159 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Apple |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-159 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 33.5 kDa |
| AA Sequence : | GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | MALD1; Allergen Mal d I Allergen: Mal d 1; |
| UniProt ID | P43211 |
| ◆ Recombinant Proteins | ||
| MALD1-2071M | Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged | +Inquiry |
| MALD1-5687A | Recombinant Pyrus malus MALD1 Protein (Met1-Asn159), N-His tagged | +Inquiry |
| Mald1-01H | Recombinant Malus Domestica (Apple) Mal d 1 protein, His-tagged | +Inquiry |
| MALD1-1992A | Recombinant Apple MALD1 Protein (2-159 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALD1 Products
Required fields are marked with *
My Review for All MALD1 Products
Required fields are marked with *




