Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged
Cat.No. : | MALD1-2071M |
Product Overview : | Recombinant Malus Domestica (Apple) (Pyrus malus) MALD1 Protein (2-159 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Malus Domestica |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-159 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.5 kDa |
AA Sequence : | GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | MALD1; Allergen Mal d I Allergen: Mal d 1; |
UniProt ID | P43211 |
◆ Recombinant Proteins | ||
Mald1-01H | Recombinant Malus Domestica (Apple) Mal d 1 protein, His-tagged | +Inquiry |
MALD1-1992A | Recombinant Apple MALD1 Protein (2-159 aa), His-SUMO-tagged | +Inquiry |
MALD1-5687A | Recombinant Pyrus malus MALD1 Protein (Met1-Asn159), N-His tagged | +Inquiry |
MALD1-2071M | Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALD1 Products
Required fields are marked with *
My Review for All MALD1 Products
Required fields are marked with *