Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged

Cat.No. : MALD1-2071M
Product Overview : Recombinant Malus Domestica (Apple) (Pyrus malus) MALD1 Protein (2-159 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Malus Domestica
Source : Yeast
Tag : His
Protein Length : 2-159 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.5 kDa
AA Sequence : GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms MALD1; Allergen Mal d I Allergen: Mal d 1;
UniProt ID P43211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MALD1 Products

Required fields are marked with *

My Review for All MALD1 Products

Required fields are marked with *

0
cart-icon