Recombinant Malus Domestica (Apple) Mal d 1 protein, His-tagged
Cat.No. : | Mald1-01H |
Product Overview : | Recombinant Malus Domestica (Apple) Mal d 1 protein with N-terminal His6 fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Malus Domestica |
Source : | E.coli |
Tag : | His |
Protein Length : | 180 |
Description : | MALD1 is a ribonuclease and a heat-sensitive allergen which is a member of the pathogenesis-related protein class. MALD1 shares homologous IgE epitopes with major birch pollen allergen Bet v 1 and Cor a 1 from hazelnut pollen. |
Form : | Buffered aqueous solution |
Molecular Mass : | 19.7 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Binds IgE type human antibodies. 2. Immunodot test with positive/negative sera panels. |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.52 mg/ml |
Storage Buffer : | Solution in 50 mM Tris, 0.3M NaCl, pH 8.0 |
Gene Name | Mal d1 |
Official Symbol | Mal d1 |
Synonyms | Major allergen Mal d 1, Ypr10 protein, MALD1, ypr10, Mal d 1.0108 |
Gene ID | 103425641 |
mRNA Refseq | Z72427.1 |
Protein Refseq | CAA96536.1 |
UniProt ID | Q43551 |
◆ Recombinant Proteins | ||
Mald1-01H | Recombinant Malus Domestica (Apple) Mal d 1 protein, His-tagged | +Inquiry |
MALD1-5687A | Recombinant Pyrus malus MALD1 Protein (Met1-Asn159), N-His tagged | +Inquiry |
MALD1-1992A | Recombinant Apple MALD1 Protein (2-159 aa), His-SUMO-tagged | +Inquiry |
MALD1-2071M | Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mald1 Products
Required fields are marked with *
My Review for All Mald1 Products
Required fields are marked with *