Recombinant Bacillus thuringiensis cry1Ab Protein, His-tagged

Cat.No. : cry1Ab-01B
Product Overview : Recombinant Bacillus Thuringiensis Cry1Ab Protein (1022-1155aa) with a N-terminal 6xHis tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bacillus thuringiensis
Source : E.coli
Tag : His
Protein Length : 1022-1155 a.a.
Description : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of lepidopteran (Manduca sexta) larvae.
Molecular Mass : 17.3 kDa
AA Sequence : HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Purity : >90% as determined by SDS-PAGE.
Gene Name BTHUR0008_RS31135 insecticidal delta-endotoxin Cry8Ea1 family protein [ Bacillus thuringiensis serovar berliner ATCC 10792 ]
Official Symbol cry1Ab
Synonyms BTHUR0008_RS31135; insecticidal delta-endotoxin Cry8Ea1 family protein; insecticidal delta-endotoxin Cry8Ea1 family protein; cry1Ab
Gene ID 67470639
Protein Refseq WP_000369819
UniProt ID P0A370

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All cry1Ab Products

Required fields are marked with *

My Review for All cry1Ab Products

Required fields are marked with *

0

Inquiry Basket

cartIcon