Recombinant Bacillus Thuringiensis Subsp. Kurstaki CRY1AB Protein (1022-1155 aa), His-SUMO-tagged
Cat.No. : | CRY1AB-962B |
Product Overview : | Recombinant Bacillus Thuringiensis Subsp. Kurstaki CRY1AB Protein (1022-1155 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus thuringiensis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1022-1155 aa |
Description : | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 31.3 kDa |
AA Sequence : | HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P0A370 |
◆ Native Proteins | ||
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY1AB Products
Required fields are marked with *
My Review for All CRY1AB Products
Required fields are marked with *
0
Inquiry Basket